PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011083049.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ARF
Protein Properties Length: 839aa    MW: 93956.4 Da    PI: 6.5141
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011083049.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.99.5e-24143244199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD ++F   + ++
  XP_011083049.1 143 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL--RGEN 234
                     99*****************************7333.34459************************************************..4499 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     +el+v+v+r+
  XP_011083049.1 235 GELRVGVRRA 244
                     99*****996 PP

2Auxin_resp123.61.4e-40269351183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha++tk++F+v+Y+Pr+s++eF+v+++++++++k+++s+GmRfkm+fe+e+++e+r++Gt+vg++d+dp rWp+SkWr+Lk
  XP_011083049.1 269 AWHAIQTKTMFTVYYKPRTSPAEFIVPYDQYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPKRWPESKWRCLK 351
                     89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-40139272IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.8E-42139258IPR015300DNA-binding pseudobarrel domain
CDDcd100177.54E-22141243No hitNo description
SMARTSM010192.0E-23143245IPR003340B3 DNA binding domain
PROSITE profilePS5086312.012143245IPR003340B3 DNA binding domain
PfamPF023621.1E-21143244IPR003340B3 DNA binding domain
PfamPF065071.0E-37269351IPR010525Auxin response factor
PfamPF023092.9E-11707805IPR033389AUX/IAA domain
SuperFamilySSF542772.81E-11712792No hitNo description
PROSITE profilePS5174523.027715797IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 839 aa     Download sequence    Send to blast
MDASEVVIKG YSETNDCDSG PEKGNSGAGK VDAETALYTE LWRACAGPLV TVPREQELVF  60
YFPQGHIEQV EASTNQSADQ QLPVYNLPPK ILCRVVNVHL KAEPDTDEVF AQVTLMPEPN  120
QDENAVKKEP LPSPPPHFHV HSFCKTLTAS DTSTHGGFSV LRRHADECLP PLDMSRQPPT  180
QELVAKDLHG NEWRFRHIFR GQPRRHLLQS GWSVFVSSKR LVAGDAFIFL RGENGELRVG  240
VRRAMRQQSN APSSVISSHS MHLGVLATAW HAIQTKTMFT VYYKPRTSPA EFIVPYDQYM  300
ESVKNNYSIG MRFKMRFEGE EAPEQRFTGT IVGIEDADPK RWPESKWRCL KVRWDETSTV  360
PRPERVSPWK IEHALSPPAL NPLPVPRPKR PRPSALPTSP DSSVLTREGS SKMTVDPSPA  420
SGFPRVLQGQ EVSTLRGSFA DSNDSDSSEK PLLWNPSLDD GKIDCALRRN ESDIWLPSGR  480
SSFTDLLSTF GSKISSPRDF SRRPADQASY KRQTQEREAK FSSIGNTWSI MQSGLSLNLM  540
DSGLKNHVRG ADTSYQTHGD VRYDVFGEFS MIPDSRGENQ QTNWLMPPPV SSYHQPPAAH  600
SREQIPRSVI AQHHAPMKPN EGKCKLFGIP LISNPAPIEP EPVHRNVVIE PSVHIPHLVH  660
SHLSPAIESD QRSDLSKGSK VFDYPVATSE QDKQFHTLPP VARDRESKGH SGSTRSCTKV  720
HKQGSALGRS VDLAKFDNYD ELISELDNLF EFNGELKARN KNWLVVYTDD EDDMMLVGDD  780
PWEEFCGMVR KILILTKEEV QRMSPGTFNS KREETSSATE GVDAKEVKDL PTSLSPDDC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1713637218353Auxin response factor 1
4ldw_A1e-1713637218353Auxin response factor 1
4ldw_B1e-1713637218353Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1388392KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083049.10.0PREDICTED: auxin response factor 2
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLA0A022Q1X60.0A0A022Q1X6_ERYGU; Auxin response factor
STRINGPGSC0003DMT4000367650.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26182444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2